Jeevika India — Connecting Talent, Creating Futures
EXPERIENCE 0–0 years
SALARY ₹100,000 – ₹300,000 P.A.
LOCATION Noida, Uttar Pradesh
EMPLOYMENT Full time
WORK MODE Field
OPENINGS 1

Job description

Frontend Engineer Posted by Service based Corporate in B2B IT Services Domain Noida Posted: imported by Jeevika JobsPopular categoriesIT jobsSales jobsMarketing jobsData Science jobsHR jobsEngineering jobsJobs in demandFresher jobsMNC jobsRemote jobsWork from home jobsWalk-in jobsPart-time jobsJobs by locationJobs in DelhiJobs in MumbaiJobs in BangaloreJobs in HyderabadJobs in ChennaiJobs in PuneCompaniesExplore categoriesUnicornMNCStartupProduct basedInternetExplore collectionsTop companiesIT companiesFintech companiesSponsored companiesFeatured companiesResearch companies by AmbitionboxInterview questionsCompany salariesCompany reviewsSalary CalculatorServicesAI career toolsNeo AI job agentResume score checkerAI resume makerInterview Q&AAI mock interviewLive AI interviewPremium servicesNaukri ProMost popularExpert resume writingExpert power profileAI BootcampsNewFree resourcesResume samplesJob letter samplesSearch jobs hereLoginRegisterFor employersBuy onlineNaukri Talent CloudEmployer LoginFrontend EngineerSoul Ai3.039 Reviews2 - 4 yearsNot DisclosedNoidaPosted: 6 days agoOpenings: 1Applicants: 100+Frontend EngineerSoul Ai3.039 ReviewsJob description:. Soul AI is a pioneering company founded by IIT Bombay and IIM Ahmedabad alumni, with a strong founding team from IITs, NITs, and BITS. We specialize in delivering high-quality human-curated data and AI-first scaled operations services. Based in San Francisco and Hyderabad, we are a fast-moving team on a mission to build AI for Good, driving innovation and societal impact. Role Overview:. We are looking for a skilled and detail-oriented Front-End Developer to join our clients product and engineering team. You will be responsible for translating UI/UX designs into high-quality code, building responsive interfaces, and ensuring a seamless user experience across devices and browsers. You should have a deep understanding of JavaScript, HTML, CSS, and modern front-end frameworks like React or Vue, along with a passion for performance, accessibility, and clean code. Responsibilities:. Convert UI/UX designs into responsive and accessible front-end code. Develop new user-facing features using modern JavaScript frameworks (React/Vue/Angular). Optimize applications for performance, scalability, and cross-browser compatibility. Collaborate with designers, product managers, and backend engineers to deliver polished products. Integrate APIs and manage asynchronous data flows (REST, GraphQL). Write unit and integration tests to ensure code quality. Participate in code reviews and maintain front-end documentation. Stay up to date with the latest front-end technologies and best practices. Required Skills:. Strong proficiency in JavaScript (ES6+), HTML5, and CSS3. Experience with React.js, Vue.js, or Angular. Familiarity with TypeScript and component-based architecture. Solid understanding of responsive design, flexbox, and CSS Grid. Hands-on experience with Git, browser dev tools, and debugging techniques. Knowledge of RESTful APIs, fetch, axios, or similar. Ability to implement accessibility standards (WCAG, ARIA). Experience with Webpack, Vite, or other bundlers. Nice to Have:. Experience with Next.js, Nuxt.js, or SSR concepts. Familiarity with Tailwind CSS, Material UI, or other design systems. Basic understanding of Figma or working with design files. Exposure to Cypress, Playwright, or Jest for testing. Understanding of SEO principles and performance optimization techniques. Experience deploying front-end apps via Vercel, Netlify, or CI/CD pipelines. Educational Qualifications:. Bachelors degree in Computer Science, Engineering, or a related field. Equivalent practical experience or portfolio of work may substitute formal education. Role: Front End Developer,Industry Type: IT Services & Consulting,Department: Engineering - Software & QA,Employment Type: Full Time, PermanentRole Category: Software DevelopmentEducationUG: Any GraduatePG: Any PostgraduateKey SkillsSkills highlighted with ‘‘ are preferred keyskillscsshtmljavascriptresponsive designflexboxnextjscontinuous integrationwcagci/cdvue.jsreact.jsnuxtjsgitssruiwebpackfigmatypescriptgraphqlseoux designrestuxmaterial uijestcypressangularjavascript frameworksAbout companySoul AICompany InfoAddress:.Beware of imposters! Naukri.com does not promise a job or an interview in exchange of money. Fraudsters may ask you to pay in the pretext of registration fee, Refundable Fee…Read moreSimilar jobsFrontend EngineerSoul Ai3.039 reviewsMumbaireact.jsnextjscontinuous integrationcsswcagci/cdvue.jsnuxtjsgitssruiwebpackfigmahtmltypescriptgraphqlseoux designrestuxmaterial uijestjavascriptcypressangularresponsive designjavascript frameworksflexboxCsIntegrationDesignPosted 6 Days AgoFrontend EngineerNuminolabs4.525 reviewsHybrid - South Goa(Verna)TypeScriptReactJSJavaScriptReact NativeREST APIGitReduxHTML5CSS3NativeHTMLCSSPosted 3 Days AgoFrontend Engineer – Modern JS FrameworksSoul Ai3.039 reviewsChennaiuxcssui developmentuser interface designingbootstraphibernateajaxjavascriptjqueryspringnode.jsjavagitFrontend Developmentj2eejsonhtmltypescriptangularjsresponsive web designmongodbux designDesignPosted 6 Days AgoFrontend DeveloperSnetaj It Solutions3.418 reviewsHybrid - Noida(Noida Greater Noida Expressway)ReduxReact.jsAngularDartHtml/CssJavascriptCi/CdMobile Application DevelopmentPosted 11 Days AgoFrontend Engineer (Freelancer)Soul Ai3.039 reviewsChennaicssjavascriptuihtmlui/uxcontinuous integrationrestuxci/cdvue.jsfront end frameworkreact.jsangulargitwebpackresponsive designbabelweb performancetypescriptjavascript frameworksbrowser compatibilityweb application developmentPosted 6 Days AgoRoles from top companiesFullstack DeveloperService based Corporate in B2B IT Services Domain1-3 Yrs1-3 Lacs P.A.New DelhiHiring for one of these companies5d agoFullstack DeveloperFirm in IT Services Sector3-6 Yrs4-8 Lacs P.A.Noida, Mumbai, Mumbai Suburban, Navi Mumbai, BengaluruHiring for one of these companies1d agoRegister to unlockJobs you might be interested inFrontend EngineerSoul Ai3.039 reviewsGurugramPosted 6 Days AgoFrontend EngineerSoul Ai3.039 reviewsDelhi / NCRPosted 6 Days AgoFrontend Developer (React/Next.js)Soul Ai3.039 reviewsNew DelhiPosted 6 Days AgoFrontend EngineerSoul Ai3.039 reviewsKolkataPosted 6 Days AgoFrontend Developer (React/Next.js)Soul Ai3.039 reviewsNoidaPosted 6 Days AgoReviewsView all39 employee reviews1.0rated by Program Manager in HyderabadLikesVery Few good humble peopleDislikesStrong undercurrent of gender bias, transcending from above (Program/Project managers to data annotators), unfair and demotivating environment, nothing that resembles a healthy inclusive office culture, not for someone who simply wants to focus on work, do their job with integrity, and go homeRead full reviewPowered bySalary insightsCompare Soul Ai salary with similar companies.Compare salaryPowered by Recommended for youKnow moreAI-enhanced profileGet noticed by recruiters by increasing profile views upto 3 timesNaukri Pro builds an AI enhanced profile and keeps it active in searches. Home Jobs in NoidaIEIL has taken all reasonable steps to ensure that information on this site is authentic. Applicants are advised to research bonafides of advertisers independently. IEIL shall not have any responsibility in this regard. We also recommend that you visit Security Guidelines and Terms and Conditions for more comprehensive information on this aspect.Please note that Naukri will not be responsible for any information you share on the company platform.Connect with usAbout usCareersEmployer homeSitemapCreditsHelp centerSummons/NoticesGrievancesReport issuePrivacy policyTerms & conditionsFraud alertTrust & safetyApply on the goGet real-time job updates on our AppAll trademarks are the property of their respective ownersAll rights reserved © 2026 Info Edge (India) Ltd.Our businesses

Role details

Beware of job fraudJeevika India never asks candidates to pay for a job or interview. Read safety details

Warning signs

  • Requests for registration, interview, security, training or refundable fees.
  • Requests for OTPs, passwords, card details or bank-account credentials.
  • Instant selection or an offer letter without a proper interview.
  • Unrealistic salary promises or pressure to act immediately.
  • Messages from unofficial domains, personal emails or unknown numbers.
  • Requests to communicate or pay outside the employer’s verified process.
  • Requests to install unknown applications, screen-sharing tools or remote-access software.
  • Recruiters using look-alike domains, misspelled company names or unverifiable profiles.
  • Requests to purchase equipment, courses or documents from a specified person.

Protect yourself

  • Independently verify the employer, recruiter and job information.
  • Check the company’s official website, address and contact details before responding.
  • Confirm important communication through an official company email domain.
  • Request a written job description and carefully review every offer condition.
  • Never transfer money to obtain an interview, job or offer letter.
  • Do not share OTPs, passwords or confidential banking information.
  • Never install remote-access software or share your screen with an unknown recruiter.
  • Do not hand over original identity, education or employment documents.
  • Share identity documents only after verification and add the intended purpose where appropriate.
  • Keep copies of suspicious emails, messages, numbers and payment requests.
Report a suspicious job: [email protected]

Disclaimer: Company names, trademarks and logos belong to their respective owners and are displayed for identification and informational purposes. Jeevika India takes reasonable steps to present useful job information, but candidates must independently verify every employer, recruiter and opportunity before applying. Jeevika India does not guarantee interviews, selection, employment, salary, job offers or the accuracy of information supplied by third parties, and is not responsible for payments, losses or communications made outside Jeevika India.