Job description
Front End Engineer Posted by Large Telecom Company Hyderabad Posted: imported by Jeevika JobsPopular categoriesIT jobsSales jobsMarketing jobsData Science jobsHR jobsEngineering jobsJobs in demandFresher jobsMNC jobsRemote jobsWork from home jobsWalk-in jobsPart-time jobsJobs by locationJobs in DelhiJobs in MumbaiJobs in BangaloreJobs in HyderabadJobs in ChennaiJobs in PuneCompaniesExplore categoriesUnicornMNCStartupProduct basedInternetExplore collectionsTop companiesIT companiesFintech companiesSponsored companiesFeatured companiesResearch companies by AmbitionboxInterview questionsCompany salariesCompany reviewsSalary CalculatorServicesAI career toolsNeo AI job agentResume score checkerAI resume makerInterview Q&AAI mock interviewLive AI interviewPremium servicesNaukri ProMost popularExpert resume writingExpert power profileAI BootcampsNewFree resourcesResume samplesJob letter samplesSearch jobs hereLoginRegisterFor employersBuy onlineNaukri Talent CloudEmployer LoginFront End EngineerNxtwave Disruptive Technologies(Hiring for a client)3.31.5K Reviews2 - 5 years8-10 Lacs P.A. HyderabadPosted: 2 weeks agoOpenings: 1Applicants: 100+Front End EngineerNxtwave Disruptive Technologies(Hiring for a client)3.31.5K ReviewsJob description About the RoleWe are looking for a Frontend Developer with 2+ years of hands-on React.js experience to build and ship production-ready web applications. This is a lead-track, hands-on role involving feature ownership, code reviews, mentoring 13 developers/interns, and frontend delivery.Key ResponsibilitiesBuild responsive, accessible UIs using React.js, TypeScript, HTML5, and CSS3.Convert Figma designs into reusable, pixel-accurate components.Work with Redux Toolkit / Zustand / React Query and REST/GraphQL APIs.Use Cursor, Claude Code, GitHub Copilot, or similar AI coding tools responsibly.Own production deployments, debugging, monitoring, and rollbacks.Work with Git, CI/CD, Vercel/Netlify/AWS/Docker/Kubernetes.Write and maintain tests using Jest and React Testing Library.Review PRs, maintain coding standards, and troubleshoot production issues.Mentor 1–3 junior developers/interns and act as the frontend technical owner for the pod.Collaborate with Product, Design, and Backend teams.Must-Have Skills2+ years of production experience with React.jsStrong TypeScript skillsStrong HTML5, CSS3, Flexbox, Grid, Responsive DesignExperience with Redux/Zustand/React QueryREST API integrationStrong Git and PR workflow knowledgeHands-on production deployment and troubleshooting experienceExperience with AI coding assistantsJest + React Testing LibraryPrevious experience mentoring or reviewing other developersGood to HaveNext.js, SSR/SSGGitHub Actions / CI/CDAWS/GCP, Docker, KubernetesWeb performance / Core Web VitalsWCAG accessibilityNode.js/Express, WebSocketsStorybook / Micro-frontendsPublic GitHub or shipped side projectsRole TypeHands-on Development Technical Ownership Lead Track Not a People-Management RoleRole: Front End Developer,Industry Type: Education / Training,Department: Engineering - Software & QA,Employment Type: Full Time, PermanentRole Category: Software DevelopmentEducationUG: Any GraduateKey SkillsSkills highlighted with ‘‘ are preferred keyskillsTypeScriptCSSHooksHTMLReact.jsReact Testing LibraryFigmaNextjsAbout companyNxtwave Disruptive Technologies (Hiring for a client)Company InfoAddress:Ground Floor, Survey No 115/22 115/23, Plot No 30,, Hyderabad, Telangana, IndiaBeware of imposters! Naukri.com does not promise a job or an interview in exchange of money. Fraudsters may ask you to pay in the pretext of registration fee, Refundable Fee…Read moreSimilar jobsFront End EngineerNxtwave Disruptive Technologies(Hiring for a clien...3.31462 reviewsHybrid - Noida, Greater NoidaTypeScriptFrontend DevelopmentJavaScriptNext.jsReact.jsTailwind CSSRedux/Redux Toolkitand Git.Posted 9 Days AgoFrontend EngineerSoul Ai3.039 reviewsMumbaireact.jsnextjscontinuous integrationcsswcagci/cdvue.jsnuxtjsgitssruiwebpackfigmahtmltypescriptgraphqlseoux designrestuxmaterial uijestjavascriptcypressangularresponsive designjavascript frameworksflexboxCsIntegrationDesignPosted 6 Days AgoFrontend DeveloperSnetaj It Solutions3.418 reviewsHybrid - Noida(Noida Greater Noida Expressway)ReduxReact.jsAngularDartHtml/CssJavascriptCi/CdMobile Application DevelopmentPosted 11 Days AgoFrontend EngineerSoul Ai3.039 reviewsMumbaiReactRESTful APITypeScriptCSSBabelJavaScriptHTMLGraphSQLVue jsWebpackAngularPosted 6 Days AgoFrontend EngineerNuminolabs4.525 reviewsHybrid - South Goa(Verna)TypeScriptReactJSJavaScriptReact NativeREST APIGitReduxHTML5CSS3NativeHTMLCSSPosted 3 Days AgoRoles from top companiesFullstack DeveloperLarge Telecom Company3-6 Yrs6-11 Lacs P.A.Hyderabad, Pune, Gurugram, Chennai, BengaluruHiring for one of these companies3d agoJava Full Stack DeveloperTop Company specializing in FinTech2-5 Yrs6-11 Lacs P.A.GurugramHiring for one of these companies3d agoRegister to unlockJobs you might be interested inFront End Developer- Gurugram Work from OfficeResource recruiterPosted by Resource RecruiterGurugramPosted 18 Days AgoReact UI DeveloperInfobeans3.4489 reviewsIndorePosted 18 Days AgoFront End DeveloperOpey AssuredefenceBengaluruPosted 25 Days AgoFullstack DeveloperMindpath Technology3.718 reviewsIndore(Khandwa Road )Posted 14 Days AgoFrontend DeveloperAlthi Solutions3.66 reviewsKanyakumariPosted 14 Days AgoReviewsView all1.5K employee reviews3.0rated by Software Developer in HyderabadLikesGood company and office culture.DislikesNo prior during the layoffs and I kept an EMI because I had a Job and before any prior notice they terminated on the same dayRead full reviewPowered bySalary insightsCompare Nxtwave Disruptive Technologies(Hiring for a client) salary with similar companies.Compare salaryPowered byBenefits & PerksView all31 employees reported these benefitsLearning & Development SupportHealth & Wellness SupportPerformance BonusFree MealTransport / Travel SupportGenerous & Flexible LeavesPowered by Recommended for youKnow moreAI-enhanced profileGet noticed by recruiters by increasing profile views upto 3 timesNaukri Pro builds an AI enhanced profile and keeps it active in searches. Home Jobs in HyderabadIEIL has taken all reasonable steps to ensure that information on this site is authentic. Applicants are advised to research bonafides of advertisers independently. IEIL shall not have any responsibility in this regard. We also recommend that you visit Security Guidelines and Terms and Conditions for more comprehensive information on this aspect.Please note that Naukri will not be responsible for any information you share on the company platform.Connect with usAbout usCareersEmployer homeSitemapCreditsHelp centerSummons/NoticesGrievancesReport issuePrivacy policyTerms & conditionsFraud alertTrust & safetyApply on the goGet real-time job updates on our AppAll trademarks are the property of their respective ownersAll rights reserved © 2026 Info Edge (India) Ltd.Our businesses
Role details
Beware of job fraudJeevika India never asks candidates to pay for a job or interview. Read safety details
Warning signs
- Requests for registration, interview, security, training or refundable fees.
- Requests for OTPs, passwords, card details or bank-account credentials.
- Instant selection or an offer letter without a proper interview.
- Unrealistic salary promises or pressure to act immediately.
- Messages from unofficial domains, personal emails or unknown numbers.
- Requests to communicate or pay outside the employer’s verified process.
- Requests to install unknown applications, screen-sharing tools or remote-access software.
- Recruiters using look-alike domains, misspelled company names or unverifiable profiles.
- Requests to purchase equipment, courses or documents from a specified person.
Protect yourself
- Independently verify the employer, recruiter and job information.
- Check the company’s official website, address and contact details before responding.
- Confirm important communication through an official company email domain.
- Request a written job description and carefully review every offer condition.
- Never transfer money to obtain an interview, job or offer letter.
- Do not share OTPs, passwords or confidential banking information.
- Never install remote-access software or share your screen with an unknown recruiter.
- Do not hand over original identity, education or employment documents.
- Share identity documents only after verification and add the intended purpose where appropriate.
- Keep copies of suspicious emails, messages, numbers and payment requests.
Disclaimer: Company names, trademarks and logos belong to their respective owners and are displayed for identification and informational purposes. Jeevika India takes reasonable steps to present useful job information, but candidates must independently verify every employer, recruiter and opportunity before applying. Jeevika India does not guarantee interviews, selection, employment, salary, job offers or the accuracy of information supplied by third parties, and is not responsible for payments, losses or communications made outside Jeevika India.