Job description
Frontend Developer (React.js) Posted by Leading Indian Firm in IT Sector Thiruvananthapuram Posted: imported by Jeevika JobsPopular categoriesIT jobsSales jobsMarketing jobsData Science jobsHR jobsEngineering jobsJobs in demandFresher jobsMNC jobsRemote jobsWork from home jobsWalk-in jobsPart-time jobsJobs by locationJobs in DelhiJobs in MumbaiJobs in BangaloreJobs in HyderabadJobs in ChennaiJobs in PuneCompaniesExplore categoriesUnicornMNCStartupProduct basedInternetExplore collectionsTop companiesIT companiesFintech companiesSponsored companiesFeatured companiesResearch companies by AmbitionboxInterview questionsCompany salariesCompany reviewsSalary CalculatorServicesAI career toolsNeo AI job agentResume score checkerAI resume makerInterview Q&AAI mock interviewLive AI interviewPremium servicesNaukri ProMost popularExpert resume writingExpert power profileAI BootcampsNewFree resourcesResume samplesJob letter samplesSearch jobs hereLoginRegisterFor employersBuy onlineNaukri Talent CloudEmployer LoginFrontend Developer (React.js)Sequantix3.02 Reviews2 - 4 years6-10 Lacs P.A. RemoteHiring office located in ThiruvananthapuramPosted: 5 days agoOpenings: 1Applicants: 100+Frontend Developer (React.js)Sequantix3.02 ReviewsJob description Frontend Developer React.js / TypeScriptExperience: 2–4 YearsDepartment: EngineeringAbout the RoleWe are looking for a Frontend Developer with strong hands-on experience in React.js and TypeScript to build modern, scalable, responsive, and high-performance web applications.React/frontend development is the primary focus.Key ResponsibilitiesDevelop responsive and reusable UI components using React, TypeScript and Vite/Next.js.Implement state management using Redux Toolkit.Integrate REST APIs and handle loading, errors and asynchronous data effectively.Build forms using React Hook Form and Zod.Develop modern UI using Tailwind CSS and component libraries.Integrate MSAL/Azure AD for secure authentication and SSO.Implement real-time functionality using SignalR/WebSockets.Build data-driven dashboards and interactive interfaces.Optimize application performance, including rendering, bundle size and lazy loading.Follow TypeScript, ESLint, Git and code review best practices.Collaborate with backend, QA and product teams to deliver high-quality features.Leverage AI-assisted development tools such as GitHub Copilot, Cursor, ChatGPT or Claude where appropriate.Required Skills2–4 years of professional experience in frontend development.Strong hands-on experience with React.js and TypeScript.Good understanding of React Hooks, Redux Toolkit and React Router.Experience with Vite or Next.js.Strong understanding of REST APIs and asynchronous data handling.Experience with Tailwind CSS or similar modern UI frameworks.Good knowledge of Git and collaborative development practices.Good to HaveExperience with MSAL / Azure AD / SSO.Experience with SignalR, WebSockets or real-time applications.Experience with TanStack Query / React Query and TanStack Table.Experience with React Hook Form and Zod.Experience with shadcn/ui or similar component libraries.Exposure to Node.js / Express.js.Experience with AI/LLM-based applications.Microsoft Power Apps / Power Platform experience will be an advantage.What We’re Looking ForWe are looking for someone who is passionate about React and modern frontend engineering, takes ownership of features, writes clean and maintainable code, and enjoys working in a collaborative product engineering environment.Interested candidates can share their CV at:[email protected]: IT & Information Security - Other,Industry Type: IT Services & Consulting,Department: IT & Information Security,Employment Type: Full Time, PermanentRole Category: IT & Information Security - OtherEducationUG: B.Tech / B.E. in Any SpecializationKey SkillsSkills highlighted with ‘‘ are preferred keyskillsGITAzure ADOREACT 19Tailwind CSSReact.jsAbout companyIT ServicesCompany InfoAddress:Ambedkar Lane, Tc 51/1757/1, Punnakkamukal, Aramad a Po, Trivandrum, Thiruvananthapuram, Kerala, 695 031, THIRUVANANTHAPURAM, Kerala, IndiaBeware of imposters! Naukri.com does not promise a job or an interview in exchange of money. Fraudsters may ask you to pay in the pretext of registration fee, Refundable Fee…Read moreSimilar jobsReact JS + Node JS DeveloperInfosys3.552186 reviewsHybrid - Hyderabad, Chennai, BengaluruNode.jsReact.jsJavascriptSQLDevelopmentNodePosted 26 Days AgoReact JS + Node JS Developer-SInfosys3.552186 reviewsHybrid - Hyderabad, Chennai, BengaluruTypeScriptMySQLReact.jsNode.jsHtml/CssMicroservicesSwaggerJavascriptBootstrapAWSNestjsRestful Web API DevelopmentExpressReduxJwtPostgresqlOpen APITailwind CSSOauthGITLinuxMongoDBReact routerPostmanMaterial UIHTMLRest Web APIPosted Few Hours AgoFrontend Developer - React.js Framework (3-8 yrs)NewbridgefintechPunereduxcssreact.jshtmljavascriptapi integrationweb applicationcloudfrontreact testing librarywebpackwireframesasstypescriptgraphqloauthux designrestfrontend developmentuxjestnode.jslambda expressionsresponsive designleawsSASWeb technologiesPosted 6 Days AgoReact JS Developer (2-3yrs)Infosys3.552186 reviewsHybrid - Hyderabad, Pune, BengaluruTypeScriptFullstack DevelopmentJavascriptReact.jsREST APIPosted 24 Days AgoAngular Frontend DeveloperCloudxtreme3.66 reviewsHyderabadTypeScriptCSSAngular 17HTMLAngular CLIGulpFrontend DevelopmentJavascriptNxWebpackCsCLIPosted 16 Days AgoRoles from top companiesPython Software DeveloperLeading Indian Firm in IT Sector2-5 Yrs3-6 Lacs P.A.ChennaiHiring for one of these companies2d agoFront End DeveloperLarge IT Services & Consulting Firm2-4 Yrs3-8 Lacs P.A.BengaluruHiring for one of these companies2d agoRegister to unlockJobs you might be interested inFullstack DeveloperSoc Software3.96 reviewsHyderabadPosted 5 Days AgoFrontend DeveloperSoul Ai3.039 reviewsRemotePosted 5 Days AgoFrontend Developer (React/Next.js)Soul Ai3.039 reviewsRemotePosted 5 Days AgoReact.js ExpertSoul Ai3.039 reviewsRemotePosted 5 Days AgoFull Stack Developer (React + Node.js)Soul Ai3.039 reviewsRemotePosted 5 Days AgoSalary insightsCompare Sequantix salary with similar companies.Compare salaryPowered by Recommended for youKnow moreAI-enhanced profileGet noticed by recruiters by increasing profile views upto 3 timesNaukri Pro builds an AI enhanced profile and keeps it active in searches. Home Jobs in ThiruvananthapuramIEIL has taken all reasonable steps to ensure that information on this site is authentic. Applicants are advised to research bonafides of advertisers independently. IEIL shall not have any responsibility in this regard. We also recommend that you visit Security Guidelines and Terms and Conditions for more comprehensive information on this aspect.Please note that Naukri will not be responsible for any information you share on the company platform.Connect with usAbout usCareersEmployer homeSitemapCreditsHelp centerSummons/NoticesGrievancesReport issuePrivacy policyTerms & conditionsFraud alertTrust & safetyApply on the goGet real-time job updates on our AppAll trademarks are the property of their respective ownersAll rights reserved © 2026 Info Edge (India) Ltd.Our businesses
Role details
Beware of job fraudJeevika India never asks candidates to pay for a job or interview. Read safety details
Warning signs
- Requests for registration, interview, security, training or refundable fees.
- Requests for OTPs, passwords, card details or bank-account credentials.
- Instant selection or an offer letter without a proper interview.
- Unrealistic salary promises or pressure to act immediately.
- Messages from unofficial domains, personal emails or unknown numbers.
- Requests to communicate or pay outside the employer’s verified process.
- Requests to install unknown applications, screen-sharing tools or remote-access software.
- Recruiters using look-alike domains, misspelled company names or unverifiable profiles.
- Requests to purchase equipment, courses or documents from a specified person.
Protect yourself
- Independently verify the employer, recruiter and job information.
- Check the company’s official website, address and contact details before responding.
- Confirm important communication through an official company email domain.
- Request a written job description and carefully review every offer condition.
- Never transfer money to obtain an interview, job or offer letter.
- Do not share OTPs, passwords or confidential banking information.
- Never install remote-access software or share your screen with an unknown recruiter.
- Do not hand over original identity, education or employment documents.
- Share identity documents only after verification and add the intended purpose where appropriate.
- Keep copies of suspicious emails, messages, numbers and payment requests.
Disclaimer: Company names, trademarks and logos belong to their respective owners and are displayed for identification and informational purposes. Jeevika India takes reasonable steps to present useful job information, but candidates must independently verify every employer, recruiter and opportunity before applying. Jeevika India does not guarantee interviews, selection, employment, salary, job offers or the accuracy of information supplied by third parties, and is not responsible for payments, losses or communications made outside Jeevika India.