Job description
Frontend Engineer Posted by Global B2B engineering & design tech firms Bengaluru Posted: imported by Jeevika JobsPopular categoriesIT jobsSales jobsMarketing jobsData Science jobsHR jobsEngineering jobsJobs in demandFresher jobsMNC jobsRemote jobsWork from home jobsWalk-in jobsPart-time jobsJobs by locationJobs in DelhiJobs in MumbaiJobs in BangaloreJobs in HyderabadJobs in ChennaiJobs in PuneCompaniesExplore categoriesUnicornMNCStartupProduct basedInternetExplore collectionsTop companiesIT companiesFintech companiesSponsored companiesFeatured companiesResearch companies by AmbitionboxInterview questionsCompany salariesCompany reviewsSalary CalculatorServicesAI career toolsNeo AI job agentResume score checkerAI resume makerInterview Q&AAI mock interviewLive AI interviewPremium servicesNaukri ProMost popularExpert resume writingExpert power profileAI BootcampsNewFree resourcesResume samplesJob letter samplesSearch jobs hereLoginRegisterFor employersBuy onlineNaukri Talent CloudEmployer LoginFrontend EngineerSoul Ai3.039 Reviews4 - 8 yearsNot DisclosedBengaluruPosted: 6 days agoOpenings: 1Applicants: 100+Frontend EngineerSoul Ai3.039 ReviewsJob descriptionWe are looking for Indias top 1% Frontend Engineers for a unique job opportunity to work with the industry leadersWho can be a part of the community?We are looking for top-tier Frontend Engineers who are experts in UI/UX and web application development using React, Angular, Vue js, HTML, CSS, and JavaScript frameworksExperience with responsive design and performance optimization is a mustIf you have experience in this field then this is your chance to collaborate with industry leadersResponsibilities:Design, develop, and optimize user interfaces using modern frontend frameworks (React, Angular, Vue)Collaborate with UX/UI designers to create responsive and interactive web applicationsOptimize web applications for speed, scalability, and cross-browser compatibilityWrite clean, maintainable code and manage version control with GitRequired Skills:Proficiency in HTML, CSS, JavaScript, and frontend frameworks (React, Angular, Vue)Strong understanding of responsive design, web performance, and cross-browser compatibilityExperience with RESTful APIs and integrating frontend with backend servicesFamiliarity with version control (Git) and unit testing frameworksNice to Have:Experience with TypeScript, GraphSQL, and server-side rendering (SSR)Familiarity with build tools (Webpack, Babel) and CI/CD pipelines.Locations : Mumbai, Delhi / NCR, Bengaluru , Kolkata, Chennai, Hyderabad, Ahmedabad, Pune, IndiaRole: Front End Developer,Industry Type: IT Services & Consulting,Department: Engineering - Software & QA,Employment Type: Full Time, PermanentRole Category: Software DevelopmentEducationUG: B.Tech / B.E. in Any SpecializationPG: Any PostgraduateDoctorate: Doctorate Not RequiredKey SkillsSkills highlighted with ‘‘ are preferred keyskillsReactRESTful APITypeScriptCSSBabelJavaScriptHTMLGraphSQLVue jsWebpackAngularAbout companySoul AICompany InfoAddress:.Beware of imposters! Naukri.com does not promise a job or an interview in exchange of money. Fraudsters may ask you to pay in the pretext of registration fee, Refundable Fee…Read moreSimilar jobsFrontend EngineerSoul Ai3.039 reviewsMumbaireact.jsnextjscontinuous integrationcsswcagci/cdvue.jsnuxtjsgitssruiwebpackfigmahtmltypescriptgraphqlseoux designrestuxmaterial uijestjavascriptcypressangularresponsive designjavascript frameworksflexboxCsIntegrationDesignPosted 6 Days AgoFrontend EngineerNuminolabs4.525 reviewsHybrid - South Goa(Verna)TypeScriptReactJSJavaScriptReact NativeREST APIGitReduxHTML5CSS3NativeHTMLCSSPosted 3 Days AgoFrontend EngineerSoul Ai3.039 reviewsHyderabadreact.jsnextjscontinuous integrationcsswcagci/cdvue.jsnuxtjsgitssruiwebpackfigmahtmltypescriptgraphqlseoux designrestuxmaterial uijestjavascriptcypressangularresponsive designjavascript frameworksflexboxCsIntegrationDesignPosted 6 Days AgoFrontend DeveloperSnetaj It Solutions3.418 reviewsHybrid - Noida(Noida Greater Noida Expressway)ReduxReact.jsAngularDartHtml/CssJavascriptCi/CdMobile Application DevelopmentPosted 11 Days AgoFront End EngineerNxtwave Disruptive Technologies(Hiring for a clien...3.31462 reviewsHybrid - Noida, Greater NoidaTypeScriptFrontend DevelopmentJavaScriptNext.jsReact.jsTailwind CSSRedux/Redux Toolkitand Git.Posted 9 Days AgoRoles from top companiesFullstack DeveloperGlobal B2B engineering & design tech firms4-6 Yrs7-12 Lacs P.A.BengaluruHiring for one of these companies3d agoSr. Frontend DeveloperAI & data-driven solutions5-7 Yrs9-12 Lacs P.A.ChennaiHiring for one of these companies3d agoRegister to unlockJobs you might be interested inFrontend EngineerSoul Ai3.039 reviewsChennaiPosted 6 Days AgoJavaScript Developer (Freelance)Soul Ai3.039 reviewsBengaluruPosted 6 Days AgoHTML/CSS Developer (Freelance)Soul Ai3.039 reviewsBengaluruPosted 6 Days AgoFrontend EngineerSoul Ai3.039 reviewsMumbaiPosted 6 Days AgoFrontend Engineer (Freelancer)Soul Ai3.039 reviewsBengaluruPosted 6 Days AgoReviewsView all39 employee reviews1.0rated by Program Manager in HyderabadLikesVery Few good humble peopleDislikesStrong undercurrent of gender bias, transcending from above (Program/Project managers to data annotators), unfair and demotivating environment, nothing that resembles a healthy inclusive office culture, not for someone who simply wants to focus on work, do their job with integrity, and go homeRead full reviewPowered bySalary insightsCompare Soul Ai salary with similar companies.Compare salaryPowered by Recommended for youKnow moreAI-enhanced profileGet noticed by recruiters by increasing profile views upto 3 timesNaukri Pro builds an AI enhanced profile and keeps it active in searches. Home Jobs in BengaluruIEIL has taken all reasonable steps to ensure that information on this site is authentic. Applicants are advised to research bonafides of advertisers independently. IEIL shall not have any responsibility in this regard. We also recommend that you visit Security Guidelines and Terms and Conditions for more comprehensive information on this aspect.Please note that Naukri will not be responsible for any information you share on the company platform.Connect with usAbout usCareersEmployer homeSitemapCreditsHelp centerSummons/NoticesGrievancesReport issuePrivacy policyTerms & conditionsFraud alertTrust & safetyApply on the goGet real-time job updates on our AppAll trademarks are the property of their respective ownersAll rights reserved © 2026 Info Edge (India) Ltd.Our businesses
Role details
Beware of job fraudJeevika India never asks candidates to pay for a job or interview. Read safety details
Warning signs
- Requests for registration, interview, security, training or refundable fees.
- Requests for OTPs, passwords, card details or bank-account credentials.
- Instant selection or an offer letter without a proper interview.
- Unrealistic salary promises or pressure to act immediately.
- Messages from unofficial domains, personal emails or unknown numbers.
- Requests to communicate or pay outside the employer’s verified process.
- Requests to install unknown applications, screen-sharing tools or remote-access software.
- Recruiters using look-alike domains, misspelled company names or unverifiable profiles.
- Requests to purchase equipment, courses or documents from a specified person.
Protect yourself
- Independently verify the employer, recruiter and job information.
- Check the company’s official website, address and contact details before responding.
- Confirm important communication through an official company email domain.
- Request a written job description and carefully review every offer condition.
- Never transfer money to obtain an interview, job or offer letter.
- Do not share OTPs, passwords or confidential banking information.
- Never install remote-access software or share your screen with an unknown recruiter.
- Do not hand over original identity, education or employment documents.
- Share identity documents only after verification and add the intended purpose where appropriate.
- Keep copies of suspicious emails, messages, numbers and payment requests.
Disclaimer: Company names, trademarks and logos belong to their respective owners and are displayed for identification and informational purposes. Jeevika India takes reasonable steps to present useful job information, but candidates must independently verify every employer, recruiter and opportunity before applying. Jeevika India does not guarantee interviews, selection, employment, salary, job offers or the accuracy of information supplied by third parties, and is not responsible for payments, losses or communications made outside Jeevika India.