Nuxt / Next.js Developer (Vue & Next Stack)
Job description
Nuxt / Next.js Developer (Vue & Next Stack) Posted by Service based Corporate in B2B IT Services Domain Gurugram Posted: imported by Jeevika JobsPopular categoriesIT jobsSales jobsMarketing jobsData Science jobsHR jobsEngineering jobsJobs in demandFresher jobsMNC jobsRemote jobsWork from home jobsWalk-in jobsPart-time jobsJobs by locationJobs in DelhiJobs in MumbaiJobs in BangaloreJobs in HyderabadJobs in ChennaiJobs in PuneCompaniesExplore categoriesUnicornMNCStartupProduct basedInternetExplore collectionsTop companiesIT companiesFintech companiesSponsored companiesFeatured companiesResearch companies by AmbitionboxInterview questionsCompany salariesCompany reviewsSalary CalculatorServicesAI career toolsNeo AI job agentResume score checkerAI resume makerInterview Q&AAI mock interviewLive AI interviewPremium servicesNaukri ProMost popularExpert resume writingExpert power profileAI BootcampsNewFree resourcesResume samplesJob letter samplesSearch jobs hereLoginRegisterFor employersBuy onlineNaukri Talent CloudEmployer LoginNuxt / Next.js Developer (Vue & Next Stack)Webreinvent Technologies4.096 Reviews2 - 5 years3-8 Lacs P.A. Gurugram( Sector 48 )Posted: 6 days agoOpenings: 2Applicants: 100+Nuxt / Next.js Developer (Vue & Next Stack)Webreinvent Technologies4.096 ReviewsJob description Job Summary:WebReinvent Technologies is seeking a specialized Developer with 3 to 5 years of experience to build scalable web applications exclusively using the Nuxt.js, Next.js, and Vue.js ecosystemKey Responsibilities:Develop server-side rendered (SSR) and static site generation (SSG) applications using Nuxt.js or Next.js.Build modular components using Vue 3 Composition API or Next.js App Router patterns.Implement efficient state management using Pinia, Vuex, or Next.js Server Components.Optimize application performance for SEO and speed within the Vue/Next ecosystem.Integrate RESTful APIs using Nuxt/Next data fetching methods (useFetch, getServerSideProps, etc.).Collaborate with backend teams to define API contracts and data structures.Ensure code quality and maintainability within Vue/Next project structures.Required Skills:Experience: 3 to 5 years in frontend development.Frameworks: Deep proficiency in Nuxt.js, Next.js, and Vue.js.Language: Strong proficiency in TypeScript and JavaScript (ES6+).Ecosystem: Knowledge of Pinia, Vuex, Nuxt Modules, and Next.js Middleware.Tools: Git, Vite, Webpack, and Nuxt/Next build pipelines.Education: Any Graduate.Preferred Skills:Experience with Nuxt or Next.jsFamiliarity with Vue DevTools and Next.js debugging tools.Role: Front End Developer,Industry Type: IT Services & Consulting,Department: Engineering - Software & QA,Employment Type: Full Time, PermanentRole Category: Software DevelopmentEducationUG: Any GraduateKey SkillsSkills highlighted with ‘‘ are preferred keyskillsVue.jsNuxtjsNextjsAbout companyWebReinvent is a software development company that provides a range of end-to-end software product development services. WebReinvent is the only company in the Asia continent that manages to become the official partner of extremely popular frameworks like Laravel, VueJs & NuxtJs. Also, we're able to develop a few open-source products like VaahCMS, VaahSaaS, etc. A perfect place to learn these technologies and international-level processes & methods to develop enterprise-level software products. Company InfoAddress:Unit 606, Sector 48, Capital Business Park, Sohna Road, Gurugram, Gurugram, Haryana, GURGAON, Haryana, IndiaBeware of imposters! Naukri.com does not promise a job or an interview in exchange of money. Fraudsters may ask you to pay in the pretext of registration fee, Refundable Fee…Read moreSimilar jobsReact /Next JS DeveloperPURETECH CODEX4.513 reviewsPuneTypeScriptJavascriptRest ApiReact.jsNextjsCss/Css3CMSHtml5bJSONCi/CdEcommerce DomainDNSAPICSSPosted 11 Days AgoReact JS+ Next JS DeveloperTata Consultancy Services3.2121805 reviewsKolkata, Hyderabad, BengaluruTypeScriptReact.jsNextjsDevelopmentJavascriptPosted 26 Days AgoFullstack DeveloperEsta Global4.510 reviewsHybrid - KolkataNode.jsReact.jsNextjsTypeScriptGITGithubReduxRest APIsJavascriptTailwind CSSAWSDevelopmentRestPosted 20 Days AgoNodejs DeveloperLeading ClientPosted by Rudr Consultancy ServicesUdaipur, Jaipurnodejs developerfront endhtml5storage solutionsreactjavascriptpackage managementhigh availabilitydata storagegitdesigndata protectioncss3PackagingManagementHTMLCSSEndPosted 6 Days AgoFrontend Developer - React.js Framework (3-8 yrs)NewbridgefintechPunereduxcssreact.jshtmljavascriptapi integrationweb applicationcloudfrontreact testing librarywebpackwireframesasstypescriptgraphqloauthux designrestfrontend developmentuxjestnode.jslambda expressionsresponsive designleawsSASWeb technologiesPosted 7 Days AgoRoles from top companiesFullstack DeveloperService based Corporate in B2B IT Services Domain1-3 Yrs1-3 Lacs P.A.New DelhiHiring for one of these companies5d agoFullstack DeveloperMid-sized B2B & B2C fintech platform1-5 Yrs7-12 Lacs P.A.Noida, Ghaziabad, New Delhi, Faridabad, GurugramHiring for one of these companies3d agoRegister to unlockJobs you might be interested inBackend EngineerOriserve2.755 reviewsNoidaPosted 7 Days AgoReact.js DeveloperTechavidus4.623 reviewsDelhi / NCRPosted 5 Days AgoFront End EngineerNxtwave Disruptive Techno...3.31462 reviewsHybrid - Noida, Greater NoidaPosted 9 Days AgoJavaScript DeveloperSoul Ai3.039 reviewsGurugramPosted 6 Days AgoJavaScript DeveloperSoul Ai3.039 reviewsNoidaPosted 6 Days AgoReviewsView all96 employee reviews5.0rated by Front end Developer in GurugramLikesI’ve been working as a developer at WebReinvent for around 3.7 years now, and honestly, my experience has been quite different from some of the negative reviews I’ve come across here. From what I’ve seen on the inside, a lot of concerns people raise about transparency and tracking systems don’t really reflect the full picture. In my day-to-day work, these systems feel more like a way to maintain accountability and productivity rather than unnecessary micromanagement. In my experience, the company has been fair to employees who genuinely want to work and contribute. Personally, I’ve never received any warning or violation email because I focus on my responsibilities and deliverables. I’ve also seen situations where strict action was taken against individuals who were clearly not working and were caught misusing time. In those cases, blaming the tracking or punch systems felt more like an excuse than an actual issue. Internally, most people understand what really happened without needing to point fingers. Overall, this is a place that works well for people who are serious about their growth and productivity. If you look at transparency as something that helps you improve rather than control you, the work environment actually feels quite fair and supportive.DislikesThoda structured environment hai, so adjustment time lag sakta haiRead full reviewPowered bySalary insightsFront end Developer in Webreinvent Technologies typically earns between₹3.2 - ₹4.7 L/yrSee detailed salary breakupPowered byBenefits & PerksView all7 employees reported these benefitsLearning & Development SupportPerformance BonusTransport / Travel SupportHealth & Wellness SupportFree MealPowered by Recommended for youKnow moreAI-enhanced profileGet noticed by recruiters by increasing profile views upto 3 timesNaukri Pro builds an AI enhanced profile and keeps it active in searches. Home Jobs in GurugramIEIL has taken all reasonable steps to ensure that information on this site is authentic. Applicants are advised to research bonafides of advertisers independently. IEIL shall not have any responsibility in this regard. We also recommend that you visit Security Guidelines and Terms and Conditions for more comprehensive information on this aspect.Please note that Naukri will not be responsible for any information you share on the company platform.Connect with usAbout usCareersEmployer homeSitemapCreditsHelp centerSummons/NoticesGrievancesReport issuePrivacy policyTerms & conditionsFraud alertTrust & safetyApply on the goGet real-time job updates on our AppAll trademarks are the property of their respective ownersAll rights reserved © 2026 Info Edge (India) Ltd.Our businesses
Role details
Beware of job fraudJeevika India never asks candidates to pay for a job or interview. Read safety details
Warning signs
- Requests for registration, interview, security, training or refundable fees.
- Requests for OTPs, passwords, card details or bank-account credentials.
- Instant selection or an offer letter without a proper interview.
- Unrealistic salary promises or pressure to act immediately.
- Messages from unofficial domains, personal emails or unknown numbers.
- Requests to communicate or pay outside the employer’s verified process.
- Requests to install unknown applications, screen-sharing tools or remote-access software.
- Recruiters using look-alike domains, misspelled company names or unverifiable profiles.
- Requests to purchase equipment, courses or documents from a specified person.
Protect yourself
- Independently verify the employer, recruiter and job information.
- Check the company’s official website, address and contact details before responding.
- Confirm important communication through an official company email domain.
- Request a written job description and carefully review every offer condition.
- Never transfer money to obtain an interview, job or offer letter.
- Do not share OTPs, passwords or confidential banking information.
- Never install remote-access software or share your screen with an unknown recruiter.
- Do not hand over original identity, education or employment documents.
- Share identity documents only after verification and add the intended purpose where appropriate.
- Keep copies of suspicious emails, messages, numbers and payment requests.
Disclaimer: Company names, trademarks and logos belong to their respective owners and are displayed for identification and informational purposes. Jeevika India takes reasonable steps to present useful job information, but candidates must independently verify every employer, recruiter and opportunity before applying. Jeevika India does not guarantee interviews, selection, employment, salary, job offers or the accuracy of information supplied by third parties, and is not responsible for payments, losses or communications made outside Jeevika India.